dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_014165242.1.49381 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment phenylalanine--tRNA ligase subunit beta [Flavobacterium columnare]; AA=GCF_001677395.1; RF=na; TAX=996; STAX=996; NAME=Flavobacterium columnare; strain=Pf1; AL=Complete Genome; RT=Major
Sequence length 806
Sequence
MKISYNWLKQFIKTDWSSEKTAELLTDLGLEVEGVEKFFSIKGGLEGLIVGHVLTCEKHP
NADKLKITTVDLGNGEPVQIVCGASNVAVGQKVIVATIGTKLYDKEGNSFEIKKGKIRGE
ESHGMICAEDEIGIGDSHEGIMVLDESIEVGTLASKVFNVEIDEVFEIGLTPNRADAMSH
WGVARDLRAGMLQQDISTELITPSVSSYKVEKRTLKIDVNVENTTLVPRYCGVTISDIKV
GTSPAWLQNRLKAIGLTPKNNIVDITNYVLHELGQPLHAFDASKIHGKIIVKNATEGEKF
ITLDDVERSLHKEDIMICDEKGPLCIAGVMGGKKSGVSERTTSIFLESAYFNPVSVRKTA
KRHGINSDASFRFERGIDPTITEYALKRAAILICQIAGGEMTSDIMEVYPKKIEDFPVFL
NLEKVKKIIGQEIPDEEIKNILVSLDIKVNSISKVGLGLTVPAYRVDVTREIDVIEEILR
VYGYNNIQFSQKLNATTAHSSKTEDYKVQNIVANLLVGNGFNEMMANSLTSPNYVNLSNS
LHEKNNVLMLNPLSNDLSAMRQSMLFSALEAVSFNINRKNADLRLFEFGKTYHKQLAGHE
EKMHLTLTMSGNRSKESWTNAQRPSDFFQFKGYILNIFERLGIKNIVTMPMKSDIFSEGM
IYELGASSLVEFGTIKKSILKHFDIKQEVFFADFNWNAILKHLSTNVKFIEISKYPEVRR
DLALLVDEHIEFEKILDLANKTEKNLLKRVDLFDVYQGNNLPEGKKSYAISFLLQDSTKT
LTDSQIDKVMSKLTQNFETELGATLR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]