dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_014556313.1.96088 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment intein-containing DNA gyrase subunit B [Haloquadratum walsbyi]; AA=GCF_000237865.1; RF=representative genome; TAX=768065; STAX=293091; NAME=Haloquadratum walsbyi C23; AL=Complete Genome; RT=Major
Sequence length 849
Sequence
MSHETEYGAGDIQVLEGLEAVRKRPAMYIGSTDSRGLHHLVYEVVDNAIDEALAGHCDQI
DVTLHEDGSVSVADNGRGIPVDTHEQHDIPAVEVIMTVLHAGGKFDNKSYQVSGGLHGVG
VSVVNALSRWLEVEIKRDGALWRDRFEYGEPQPGAFERVRDLDSDEETGTTIRFWPSDDI
FETTEFEFSTLENRLRELAFLNSGVEICINGETDDINSKFCFNGGIREFVKYLDETKTVL
HDSVVHYQNEQDGIEVEVALQATEELQGSIHAFANNINTREGGTHLTGFKTALTRVINDY
GREHNLLDGFDSLQGEDVREGLTAVVSIKHPDPQFEGQTKTKLGNSDVRGIVESTTHERL
GTYLEENPDVAKVIVRKAVEAAKARKAAKQAEELTRRKSALESTSLPGKLADCQSRDPAE
SELFIVEGDSAGGCFSGDTEIALASGDSITFESLVDAYERGETHYCYTIGDDGRIRIEEI
MNPRVTQEDAALLAVTLDNGEVIRCTPDHEFMLRDGNYCEAQNLTDGQSLMPLYRTTTEM
TETTETTGTAEMVKQPFAQNNWESVSQLANRYTRRHTTTDHIVETQQIQSQQQSQIETVQ
ISERADVHNHTVVSVESLTETADVYDLEVPVTHNFALASGVFVHNSAKQGRERRFQAILP
LKGKILNVEKHRLDRILENDEVRALITAIGAGIGDEFNVEDARYNRLIILSDADVDGAHI
RTLLLTLLYRHMRPLVEAGYVYAAKPPLYRIRYNGNTYDAMTKSERDQIISDVCNGNPTQ
VQRFKGLGEMNPEQLWETTMNPENRVLKQITVEDAAAADKMFSVLMGDAVEPRKEFIKDR
ATDAEWVDI

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]