dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_014620601.1.8014 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment peptidase S8 [Shewanella baltica]; AA=GCF_000215895.1; RF=na; TAX=693970; STAX=62322; NAME=Shewanella baltica OS117; strain=OS117; AL=Complete Genome; RT=Major
Sequence length 1286
Sequence
MKTKLSIAISAALLSSAAIANSEFTFKPYSPEITSHDKFSKPKVATTNLGAPQRFIVEME
SPALAKYQGGIGSFAATASAKEGQKINVQSAEVKNYANHLTKEQNNFSSALAKTVPNAKV
ERHFQTLFNGVTVVGQGLTAEKLAQMPGVKSVYPETMYEISMDASHQIINTQAMWDAVSG
MENAGKGVKVAVIDGGIRPENPMFADAGFTAPSGNLPSDDYCSTVDASFCNNKLIVARWS
QPTFPVCADEYMSPLGFGGHGTHVAGTAVGNKVSTTFKEIPVELSGVAPAAYLMVYKALY
SKADCTGGSGSNIMLMEALEHAVNDGADVINNSWGGGAGGDPASSPYKTMFEAAEAAGVV
VVTAAGNDGNGPQTIGCPACIESGITVANTTTGRFFANSFNAGGDDLLAIPSSDAVLSED
ITAPVIAAVNLDAENANGCDAFAADSFKDGIALISRGTCNFSLKATNAKAAGAKALVVYN
NAAGAPTTMSMPGEPFPAVMITKDAGLAVIEAMGDTVTTGTIVAKTKRIMVSELADNLNS
TSSRGPDGNQNILKPDIAAPGTNILSAFSPDDGGEDFNMISGTSMASPHVAGAAALMSQL
HPEWSANDIKTALTSTAKFEGILDDDAVTPATPFDMGAGRMDLDAAAKAVLTFDKPSIAS
DSCVGPCTFTRTVYNKSDATTSWSLSTSSDSTGITVSPSTLELAAGASATFTVTVDSTFA
TYGEWIFGNVLINSTEGLQNAHLPLAILAKESSNASLISTLTTKTDITASDVIPLVATVN
NNVFANTVTVTAQAPKGTKLTSKDDVKVTLAGATQNGLQVNEDLGAVTWVGQLDLPKMAT
TKGAQRFPSIVDLGVVPVTCLEGCDEQAFTFTVPSFKYNGVSYGNITISDNGLAIVGGGS
ASGTYTNKQLPDGSNPNNILAPFWSDFDLSDKSVGDTGGGDLAVGVFTDGAGVKWLALEW
NKGQLYGDTSGTSYTFSIWIRTGDTEEVVFNYIDIPNMPANVTIGAENVGGTIGTTYNFN
GTGGSIATGDALTLKNTTAGNVTINYDVKATTLNVGQADVIETNEEALVSINVLENDTKP
DMKVARVSITGDGITANAQRIIDIMPKGALGNLAIVQAPSHGTAVINSTGGIDYTPSKDY
FGSDMLSYTSADEDGNTGGAATVTIDVKNVNDAPVVAPQPQSGVAGNAITLKPNPLDVDG
DVLSYVWAQTGGETLEFTPTNENITVTPSSAGTYTFTVIANDGKLQSNTGELVLTVKSKP
DTSSGGALGWLTALLLPLAAMRRRMK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]