dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_014801677.1.12531 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment phosphoheptose isomerase [Turneriella parva]; AA=GCF_000266885.1; RF=representative genome; TAX=869212; STAX=29510; NAME=Turneriella parva DSM 21527; strain=DSM 21527; AL=Complete Genome; RT=Major
Sequence length 196
Sequence
MKDYIRAQVKDSISVKERYLADEANINQLDKICADVIAAYKAGKKTLIAGNGGSAADAQH
IAAEFVSRFYFDRPALASIALTTDTSALTAIGNDYGYELLFSRQLEANAQPGDIYIAIST
SGNSKNVLHSLEVAKKIGLKTIGLTGMKGGKMADMVDYCVRVPSDETPRIQECHILIGHI
LCAAVEKELFEKEYRK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]