dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_014953492.1.76190 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment methylenetetrahydrofolate reductase [alpha proteobacterium HIMB5]; AA=GCF_000299095.1; RF=na; TAX=859653; STAX=859653; NAME=alpha proteobacterium HIMB5; strain=HIMB5; AL=Complete Genome; RT=Major
Sequence length 242
Sequence
MNFSLEIGPHTDLSTLPAVKDVYVTLLPGGDYKETAKKSGDLVKEGFNPVPHVPARSISN
DEELKDYMNMCKDLGVKQALVIGGSREPIGKFDSSFQILETGYLEGIKIGIAGHPEGSPD
ISDQDLEKAMIDKKPYADYIVTQWLLDTQPIIDFISKQSVPVHVGITGPMKISSLIKFAN
IVGAKNSINFLKSNFSKALDLLKPKDPNDLIGKVKSHTDNFHIYTFGGLKETNKWLKENK
YV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]