dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_015131791.1.42896 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment anthranilate synthase component I [Calothrix sp. PCC 7507]; AA=GCF_000316575.1; RF=na; TAX=99598; STAX=99598; NAME=Calothrix sp. PCC 7507; strain=PCC 7507; AL=Complete Genome; RT=Major
Sequence length 472
Sequence
MTQNWYWRSLPLENRTGSEIFATLFRSTTASGIATLLESPYPTPTAHPQLSRYSICAGAP
RIVDGIPQMWTPALGEVFPFLENLLQKNPPLLPSPSPHLPFTGGWLGWLGYDIAWEIEQL
PQHKSDNLPFPVAYWYEPESFAVLDHGDQLLWLASSVQHGLDDLHKKLDKGVREEKTPPS
PSSPNWENLERQNHHPIHFHTSQTDYETSVNQVKKYIQAGDIFQANLSLRFEATTKNSGW
EIYLALQKINPSPFASYWQTPWGEVISCSPERLVLLQNGQAETRPIAGTRSRGANLEQDS
QLAQDLLSNTKERAEHIMLVDLERNDLGRVCDWGTVFVDELLTIELYSHVMHLVSNVKGS
LRCDRTAVDLIRALFPGGTITGCPKVRCMEIIEELEPVRRSLFYGSCGYLDWRGNLDLNI
LIRTLLLAPLPHSALNTVWGQVGAGIVADSDPEREWYESLHKAQAQLTALNS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]