dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_015228677.1.8022 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment RNA polymerase sigma factor, RpoD/SigA family [Dactylococcopsis salina]; AA=GCF_000317615.1; RF=representative genome; TAX=13035; STAX=292566; NAME=Dactylococcopsis salina PCC 8305; strain=PCC 8305; AL=Complete Genome; RT=Major
Sequence length 388
Sequence
MVNALTNQQQKSELERLIEEQSHEAAQGNTVALEVEPADSDLEKEALLEAEPPEEAPQKI
EATTTKEDSKKKSYTEDSIRLYLQEIGRIRLLRADEEIELARKIADLSELERTRTELEAT
IGCEPTDEEWAEEVGQALPKFRRRLLLGRRAKEKMVQSNLRLVVSIAKKYMNRGLSFQDL
IQEGSLGLIRAAEKFDHEKGYKFSTYATWWIRQAITRAIADQSRTIRLPVHLYETISRIK
KTTKILSQELARKPTEEEIAERMEMTIEKLRFIAKSAQLPISLETPIGKEEDSRLGDFIE
ADGETPEDEVSKSLLREDLEDVLDTLSPRERDVLRLRYGLEDGRMKTLEEIGQIFNVTRE
RIRQIEAKALRKLRHPNRNSILKEYIRT

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]