dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_015233380.1.8181 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment IS630 family transposase ISNagr8 [Natronobacterium gregoryi]; AA=GCF_900114025.1; RF=representative genome; TAX=44930; STAX=44930; NAME=Natronobacterium gregoryi; strain=SP2; AL=Contig; RT=Major
Sequence length 367
Sequence
MGGDRRGELVRHLSEEELDRLLDEADDPKVVKRLTFVKRLYKGATYEEAADDVGKSASTG
SRWARRWNDGGLGQLTPNFGGGRPPKLGDEEQECLLELLREGQPWKAQEVHQLLDEEFDV
EYHPDYLGRFLRNLGLSYAKPRPKRPSRPENADEILEERVADAFDEETETAHNKRPEDED
EGWVLDDDICTDGGTIVGFCDASHPQPYDNSHRLWYVDDPTLERPLVKLDEPAVGCYTLN
GESVLTFPEDQSKENICALLEEVREQNPGTRILLVLDNFSSHICEHTRKRAHQLGIDLVF
LPVGSPHLNPIEQVWKVLKRNASPIVVASESAFRTLARRLFNTLTDRLGFAKSWIDQFLS
PYLQKLS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]