dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_015271508.1.35335 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment MULTISPECIES: glutathione S-transferase [Pseudomonas]; AA=GCF_000691565.1; RF=na; TAX=303; STAX=303; NAME=Pseudomonas putida; strain=DLL-E4; AL=Complete Genome; RT=Major
Sequence length 209
Sequence
MSNPIKLYNFPKSGHAHRIELMLSLLNLPTELVFVDLAKGAHKQPDFLALNPFGQVPVID
DNGTVIADSNAILVYLAKKYDNGTWLPEEPAAAARVQRWLSVAAGPLAFGPAAARLVTVF
GASFNTDEVITRAHTLLKVIDAELAKTPFLAGSTPTIADIANYSYIAHAPEGNVSLEPYA
NVRSWLARIEALPRFVPMPRTVIGLQTSA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]