dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_015489054.1.38469 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment beta-glucosidase [Clavibacter michiganensis]; AA=GCF_000355695.1; RF=na; TAX=1097677; STAX=28447; NAME=Clavibacter michiganensis subsp. nebraskensis NCPPB 2581; strain=type strain: NCPPB 2581; AL=Complete Genome; RT=Major
Sequence length 786
Sequence
MTGAETTAASGAVELPEVSERVRELHARMTLEEKLAQIVGYWVDQGGEVVAPMQGEMATT
GKYEEATEHGLGHLTRVYGTRPVDPVERASWLWAEQRRLRTETRLGIPALVHEECLTGLA
AWQAATFPTPLAWGASFDPGLVEEMAGLIGGSMAELGVHQGLAPVLDVIRDARWGRVDEC
IAEDPYVVGTIGTAYVKGLQSAGIHATLKHFVGYSVSQSGRNHAPAHVGPRFVEDVLLPP
FEMAVLDGGVRSVMNSYAEIDGAPVGATPEYLTDVLRGRWGFDGVVVSDYFSVAFLQVMH
AVAGDRGEAAELALAAGIDVELPTGDAYLAPLAERIRAGLADESLVDRAVLRVLDEKEEL
GLLDATFDAPPTEIDLDTPAHRDVARRLAEESVVLLANDGTLPLAGAGRTAPARIALIGP
NADSAEALMGCYSFANHVLAHHPGTPLGFAITTVAEALCAELPDSDLVVVAGAEVEGDDR
SGFDAAVEAARGSDLAVVVVGDRAGLFGRGTVGEGNDVESLELPGVQRELVEAVRATGTP
VVVVLLTGRPYAVAWALEGETAPAAVLQAFFPGEEGGSAIAGVLSGRVSPSGRLPVSLPR
SAGAQPFSYLHPILGGPSEVTSADPTPVLPFGHGLSYTTFARSDLSVESAEVAAGEAFTA
TVVVRNTGDRDGTDVVQLYARDVQGSVTRPVAQLLGYLRLDLAAGESARVTFRVPTTRLA
LTDLRYRRVVEPGAVELWVGSSSAVKETQAAIAVTGSAHHVTVADERYVGTSVEAVGASE
RVLEPS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]