dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_015491259.1.98982 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment endoglucanase [Clavibacter michiganensis]; AA=GCF_001643055.1; RF=na; TAX=31963; STAX=28447; NAME=Clavibacter michiganensis subsp. nebraskensis; strain=DOAB 395; AL=Contig; RT=Major
Sequence length 461
Sequence
MPTRRRLKCAVVTAVAPAVVTATVLVAPAAGARAASAQAAPTAPAATVLSVASGPVGTPV
TVTGTGFPAKKAAVVAVGSTTKRITTTATGRFTTAITIPRTSLSTIRITATAGTRSAGAP
FTVTTAKSNGSARLGASAPAPTTTPAPAPTGAPTSTAAPAPATSSPAPAASAAPAISSAR
LRLGLSTPGGPTANGELDAASTTLGESPSIVMSHVDFTHPAPIAGLRSVAARGADSLITW
EPWQGGAGVDQPAYANARIVAGDYDSYIRSWGADLAKYGQPVYLRFGHEMNGNWYPWSDG
VNGNASGSYVQAWKHVHDLVAAQGATNVKWVWSPNVPYPGSTDLASLYPGADQVDVVALD
GYNWGAVPGQRWTAPADLFGPGMAQLRAVAPGKPLIIGEVASGETGGSKADWDRDLVAYL
QSQPDVLGFVWFDFKKEEDWRIDSSAASATALRDALALRRG

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]