dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_015634137.1.27351 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment MULTISPECIES: lysine/ornithine decarboxylase Ldc [Pseudomonas]; AA=GCF_000397205.1; RF=representative genome; TAX=1124983; STAX=380021; NAME=Pseudomonas protegens CHA0; strain=CHA0; AL=Complete Genome; RT=Major
Sequence length 387
Sequence
MSINVEDYFARETFQKMKSFADQQETPFVVIDTQMISQAYDDLRAGFEFAKVYYAVKANP
AVEIIDLLHEKGSSFDIASIYELDKVLGRGVNPANISYGNTIKKSKDIRYFYDKGVRLYA
TDSEADLRNIAKAAPGSKVYVRILTEGSTTADWPLSRKFGCQTDMAMDLLILARDLGLVP
YGVSFHVGSQQRDISVWDAAIAKVKVIFERLKEEDGIELKLINMGGGFPANYITRTNSLE
TYAEEIIRFLKEDFGDDLPEIILEPGRSLIANAGILVSEVVLVARKSRTAVERWVYTDVG
KFSGLIETMDESIKFPIWTEKKGEVEEVVIAGPTCDSADIMYENYKYGLPLNLAIGDRLY
WLSTGAYTTSYSAVEFNGFPPLKAFYV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]