dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_015884116.1.13559 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment anti-sigma factor antagonist [Beutenbergia cavernae]; AA=GCF_000023105.1; RF=representative genome; TAX=471853; STAX=84757; NAME=Beutenbergia cavernae DSM 12333; strain=DSM 12333; AL=Complete Genome; RT=Major
Sequence length 115
Sequence
MIEISTSATSTTVTIEGDLDLSTRPQFHAATAKLGAVRRPLLVIDASRITFLDSTGAAFL
ISLADATRKRGGAAVLRGADERVLFVLETCGALDFFRLDPEPGLQEGDGGTRLRG

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]