dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_015920168.1.34263 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment phenylalanine--tRNA ligase subunit beta [Thermotoga neapolitana]; AA=GCF_000018945.1; RF=representative genome; TAX=309803; STAX=2337; NAME=Thermotoga neapolitana DSM 4359; strain=DSM 4359; AL=Complete Genome; RT=Major
Sequence length 788
Sequence
MRVPESWLREFIDLDWDIEEIAERLTFSGTSVEDILKPFNVSGKIVTARVVETFQHPKSD
KLLVCRVDAGEKLYTVVTADRTVKEEDYVILALEGATLNNGVKIAPREFSGIVSEGMLCS
LEELGLEEKSDRVYRFPEPVTPGVNVIEEFGLDERVLDLEITPNRPDCLSILGVARELSA
LSRRPLKKPSPRVSFVDEDVPFDVIVEDVEGCPRYTARIMKGVTVKDSPLWLKARLVASG
MRSLNNVVDATNYVMLELGHPVHAFDLARLGNARIVVKTASGGERVLLLDEKEYEMKGGE
VLITDGENILALGGIMGGMESGVSENTRDLVLEVAYFDPVRIRKTSKSLGISSESSYRFE
RGVDPNDADLVSLKLAEMIQKLAGGVVLRKFWDVYPKKIEPKRVFLRKERVKKILGIEVE
EPDRILERLEFQVKSVENGYEVVVPTFRPDVEREIDLIEEIGRINGYEKIEPRIISLPAV
NIGWNRKQILRKEISHFMKGMGFDEIVSFSFVNSEKVKKWPVVRKEPIFLTNPISSDMDV
MRYTLFHSMIQVLSENFKRQNRNLKLFEIGKIYYRENGEYREVETLSAVACGLENPDDYT
DKRKVSFYTMKGVLDELFQRYGVRAEYREAELTGFFPTRTARIFSEGKELGFLGMVDPKL
LDEYDVKEETYFFEIDLESLAELVSERPVYKPTPKFPAVRRDVSFLLPRGFKSLEILDLF
RKMGESLVEEVGVFDVYEGKGVPEGMVSVTFYVIFRHPERTLTDEEVNQIFERMVQRVEE
KFGVKRRF

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]