dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_019436609.1.72310 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment MULTISPECIES: 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase [Pseudomonas]; AA=GCF_000494915.1; RF=na; TAX=69328; STAX=69328; NAME=Pseudomonas sp. VLB120; strain=VLB120; AL=Complete Genome; RT=Major
Sequence length 263
Sequence
MTFEHILFSVEAGVATLSLNRPEQLNSFNAAMHGEVREALKRVRQNPEVRVLLLTGEGRG
FCAGQDLADRNVAPGAEAPDLGESIEKFYNPLIRTLRDLPLPVICAVNGVAAGAGANIPL
ACDLVLAARSASFIQAFCKIGLIPDSGGTWSLPRLVGLARAKALALLGERLTAEQAEQWG
LIYRVVDDAELRDEALKLARHLATQPTYGLALIKRSLNASLNNDFDAQLDLERDLQCLAG
RSEDYREGVAAFMAKRTPVFKGR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]