dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_020961862.1.66495 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment MULTISPECIES: hypothetical protein [Thermofilum]; AA=GCF_000813245.1; RF=na; TAX=697581; STAX=1483572; NAME=Thermofilum carboxyditrophus 1505; strain=1505; AL=Complete Genome; RT=Major
Sequence length 283
Sequence
MKTKHILIIIAVLLAVSPLLGLLLGKWVDYWRIATNLGDEPAYIALTILLFYLVDPHLGV
NVLIALSTGAWLDVFMKNLFKLPRPPSELWLAPAEGYGFPSGHATTSTTFWTSLSLETRR
REVYLLGAVTVAIVCLSRIILNVHYPVDVAGGVVLGLFSSFSVYYATRKITLKPWLASLA
LALYGVAVSVLTFVQGDLNFVRLGGLLVGLAVYPLIREKINLRKESFLTKTILALVALVL
AFGFTQVAKSQAPLPQFILYLATGSITVSLPLLRSKSGRKTTG

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]