dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_023402011.1.60081 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment zinc carboxypeptidase [Pseudoalteromonas luteoviolacea]; AA=GCF_000495575.1; RF=na; TAX=1353533; STAX=43657; NAME=Pseudoalteromonas luteoviolacea 2ta16; strain=2ta16; AL=Contig; RT=Major
Sequence length 744
Sequence
MNKNIIKAGVLSALSMVTTSAYTHNQKTPEQALNLQTNQSNYLLYFDSPEQKAHYSGLYH
EQIIDASHNAFKLSLSKAEYRTILQTGVIIVEQNVAESFAAPALPKTKKSMSITPSSGAE
ELTSIPNFPCYPTVEETHKRAQQLAEKYPDFVELKTIGPSWEKSQGIGGYDLNVLVLKNK
KRNKNKQLPALFMQSVLHAREYTPGATTLRLAEHLLENRKTDADIHWILNQREIHILLIA
NPDGRKYAEQGLFWRKNTNASYCAQSEQNRGVDLNRNFDFAWATTSGSTDEQCASKFHGP
SPASEPETQAIQAYVKALFGDNRGDALNDAAPLDTPGVFIDIHSYSRFVMWPWSHETTPP
PNAAGLSMLGHRMAAYNDYLALQVSEQFNGGGSAEGYAYGELGVAAYTFELGSTFFENCS
NFEGEILPNNLQALIYAAKVAKKPYKLSGGPKIVDFRLEGAGETAVPAGTSINLIADVHD
DAFGPSLSGVAPPSQAIKKVRMTVRKQGEGRIQRLILPPVDGIYDSPREKINYALDTSDW
DDGRYTVIIKAQDTTGQWGVKYAKYLTIDDDASEQNQAPIANFTPNCTFGACKFDASNSI
DDKAGLKYRWYISNDATQFEYFGKQIEFVNQRAGTYTIALEIEDANGVRANKEVVMELQG
TVPPIAKLTYQCNGLTCEFDSSGSTDADGQIVRRLWRIGSDDGFADGDVKVTRTFPAPGE
YIVSVVVLDNHDEYSQVIETITVK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]