dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_023661594.1.54338 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment MULTISPECIES: aldehyde dehydrogenase [Pseudomonas]; AA=GCF_001306515.1; RF=na; TAX=303; STAX=303; NAME=Pseudomonas putida; strain=HB4184; AL=Contig; RT=Major
Sequence length 169
Sequence
MKTVLAAAALSLFAASAGAAELSGALGATSQGGITARAGVGFNWDKSWFESSTGRLTGYW
DAGYTYWEAGDASGGAHSLSFAPVFVYEFGSGNVKPFVEAGIGLAVFSGTSAGDQDFGSA
FNFEDRIGAGLKIGETQKVGIRAIHYSNAGIKQPNDGIESYSLFYSHQI

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]