dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_023663238.1.23948 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment MULTISPECIES: 2,3-dehydroadipyl-CoA hydratase [Pseudomonas putida group]; AA=GCF_000510285.1; RF=na; TAX=1435044; STAX=76759; NAME=Pseudomonas monteilii SB3078; strain=SB3078; AL=Complete Genome; RT=Major
Sequence length 257
Sequence
MPRYLDVQAPEQGVQLITLQRPEALNALCTELLAELAAALEAAGQDEQTRAVVITGSRKA
FAAGADIREMAERDLVGILNDPRVAHWQSIAAFAKPLIAAVNGYALGGGCELVMCADIVI
AGSDARFGQPEINLGIIPGAGGTQRLLRAVGKPLAMQMVLTGEAITAPHALQAGLVSEIT
QPELTVERALHIARGIAAKAPLAVRLAKEALLKAGDTDLASGLRFERHAFTLLAGTADRD
EGIRAFQEKRQARFQGR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]