dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_024087525.1.95207 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment MULTISPECIES: TetR/AcrR family transcriptional regulator [Pseudomonas]; AA=GCF_002194095.1; RF=na; TAX=287; STAX=287; NAME=Pseudomonas aeruginosa; strain=6014; AL=Contig; RT=Major
Sequence length 224
Sequence
MTTSSARSKASTPSKHPSSVGGAVQSEKARLVLAGARTVFLANGFSAATTDMIQQAAGVS
KSTVYSHYPNKEALFVAVVEAECERFLRAVRKPKFPEERLADILNAMALAYLEIVLSRDG
LALYRMIAAEAPRFPELGRRFYLAGPAAINNIVAETLEVAASKGELDLGSIGLDSAASLF
VNMVRGEAQMQCVMHPDAPASAAQRDRWAKDAVTTFMRAYGRDR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]