dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_024564032.1.32871 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment glycoside hydrolase [Elizabethkingia anophelis]; AA=GCF_000495975.1; RF=na; TAX=1338013; STAX=1117645; NAME=Elizabethkingia anophelis NUHP3; strain=NUHP3; AL=Contig; RT=Major
Sequence length 1096
Sequence
MTGNFIHAQKKVPYFGNINAINGYENEISGENIDYFSAFPDHATRALLTRTTDGEKTIEW
ETTKVPQKNSGPYIYFNWLVSHSSGSSGGVRNFDLYINDQKALTLSTYPANQRPTWISKA
ADSTAFVFNQTKMDGLKDSYGIAYLRVPVNKVTPGKPLRLKLVGQAQNSRDWFMTYKFTF
QEKMDANVTPFILKDGKRLITLTTLHFGPEEKIIAKIDNKESFSFTMPDGIKTFDIPVTL
SQTGGNIQLTVTSGKKELLRKTIQAGTIVPRTLYFIHHSHTDVGYSHLQAEVEKIHTKNI
YDALKMIDETRNLPEEARFKWNVEALWDVENFMQKATPEDKKAFVKAVKDGGIGLSAMYG
NILTGLSQPEELFHYTEYAQKLEKEYGFKINSAMMSDVPGFAWSLVPALTTSGVKYFSSG
PNYLGKTNPYLGDRVGNFVKNWGDKPVWWQSPSGKEKILFWTAGRGYSSWHGIHPGAVFE
TGQKKIAEYLDDLIRTNYPYDIVQWRYNIVSDNGPIDPSISKFVDDWNKKYTSPKIVLST
NEKMFEVFEKKYGDKLPVVKGDISPHWEDGAMSTAKEEGINRNSGLKLQQLTTLYSMLNP
RLYNSQTFYDAWRNVILFHEHTWGAFNSITAPDLPFVTDQWKVKRQFSLEGNSLANQLEK
DLLQPLTNPGSKKIEVFNTSSWTRSGVVTITATAEGNSVQDARGNKIPLQKLENGTMVFM
AKNIPALGSAVYTIIKNKTLATTPFIVTNNSISNGKITLTWDNKTGSITHFTDNGTTNYA
GSYNNQGLNSYWYVPGSDPKEAKSNTEVQTKILENGPVMVKVLLTAEAPGANKLERIITL
YKDSDEALLENIVDKKPIRTKESVHFGFPFNSGFKNITADAGYGIMKYLTDQLPGSNMDY
WYSRRWVDASSGQKGIQWMMIETPLTEAAEMIDERMLIDNSHKKWKDIGTTGTTNWFSYA
MNNYWHTNYKADQDGPVHYRYALRPHDSFNSVENEKYAAAFTQPLIAIPVNEKADIKGSL
FHMKNDKIVVTSITPQDDQSFIIRLYNPDEKEQTTTFTWERLKPSKLIYNKTAKEISIND
SISLNSMDVIEIKVIP

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]