dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_026149180.1.54035 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment glycoside hydrolase [Elizabethkingia meningoseptica]; AA=GCF_000367325.1; RF=na; TAX=1216967; STAX=238; NAME=Elizabethkingia meningoseptica ATCC 13253 = NBRC 12535; strain=NBRC 12535; AL=Contig; RT=Major
Sequence length 1097
Sequence
MTNSLMYAQKKVPFFGSIQSINGYATEISGENIDYFSAFPDHATRALLTRATDGAKTIEW
ETAPAPQKITAPYVYFSWLVSHSSGSSGGIRNFDLYINNQKSLTLTTYPVNQKPNWIAKA
ADSTAFVFNQTKMDGLKDSYGIAYLRIPASKVTPGKPIRLKIVGQAQDSRDWFMTYKFTF
QEKMDAASTPFILKDGKRLITLTTLHFGPEQKITATIDNKENFSFTMPDGIKTFDIPVTL
SSKGGSVALTVTSGNKQLLHKTIQAGPVVPRTLYFIHHSHTDVGYSHLQSEVEKIHTKNI
YDALKMIEETRNLPEEARFKWNVEALWDVENFMQKATAEEKKSFVKAVKEGNIGLSAMYA
NILTGLSQPEELFHYTEYAQKLEKEYGLNITSAMMSDVPGFAWSLVPALTSSGVKYFSSG
PNYLGKTNPYLGDRVGNFVKNWGDKPVWWESPSGEEKILFWTAGRGYSSWHGIHPGAVFE
NGQKKIAEYLEDLTKTNYPYDIVQWRYNIVSDNGPIDPSISKFVDEWNKKYTSPKIVLST
NEKMFEVFEKKYGDKIPVVKGDISPHWEDGAMSTAKEEGLNRNSSLKLQQLTTLYSMLNP
GQYNNQSFYEAWRNVILFHEHTWGAFNSITAPDLPFATDQWKVKKQFSLDGSTLANKLEA
DLLQPLTDPASNIIAVYNTSSWVRDGLVILPVQAQANAVQDFKGNKTPLQKLENGTMAFI
ARNIPPLSSATYTIIKDSSPKTSVFSITDHSISNGKINLTWDNKTGSITHFTDNNGTTNY
AGTFNNQGLNSYWYVPGTNPQDSQSNTNVQVNVLENGPVLAKISLTSEAPGAHRLEKIIT
LISGSDEVTLENIINKKPIRTKESVHFGFPFNKEFKNITADAGYGVMKYLTDQLPGSNMD
YWYSRRWVDASFGQKGMQWMLLEAPLIEAAEMIDERLQIDNSHKKWKDKGTPDTTNWFSY
AMNNYWHTNYKADQEGPVHYRYALRPHGTFNSVENEKYAAAFTQPLIAIPVNKKATVKGS
LFHMNNDKIVVTTITPQEDHSFIIRLYNPDEKEQSTTFIWEQLKPSKLIHLKTEKTISIN
DTISLNGMDVIEIKAIP

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]