dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_028727349.1.74405 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment glycosyl hydrolase family 38 [Parabacteroides gordonii]; AA=GCF_000428565.1; RF=na; TAX=1122931; STAX=574930; NAME=Parabacteroides gordonii DSM 23371; strain=DSM 23371; AL=Scaffold; RT=Major
Sequence length 964
Sequence
MKTPKVFFLIGIALFALSFAVWGATAPPGIDTHVYPALYKSKQGLVQKVRVSLTHTGEPE
NVTLTLAGQTQKGKLKDGANQFFFEVPEVQSTQRLPLVLTKGKEKQSTEVEVKPVRHWQM
NMVQHTHTDIGYTRSQTEILAEHLRYIDYALDYCDATDDYPDFAKFRWTCEIAWAVSEYL
KCRPAEQIARLKKRVSEGRIELAAMYLNFDELPDEQTLAASLYPLKQFREAGLKAEVAMQ
NDVNGIGWCFSEYFADAGVKYVNMGTHGHRALICFDIPTVFWWQSPSGKKVLTYRAEHYN
QGNFFGVHTDNFEQFEERVLNYLGEMEAKNYPYDIVAAQHSGYFTDNSPPSTKSCEMLMR
WNEKYEWPKLRTAVSSEFIKEVENNYADKIQTIRGAWPDWWTDGFGSGAREAAISRITHS
DIIANQAGLSFADMLGAKLPDDIDNQISGINKALLFYDEHTFGFSESVRNPYGLETWEQR
SLKQSYAWEAYRHSGLLGEVTMGLLQSFVPKAEYPSVAVFNTLNWTYSGLAKVYIDHQIL
PREKAFEITDAAGNVIPAQPAESRSDGTYWSLFVKDVPALGYAQYYIKVKDEPRPETVAS
SSLEKAHVENAWYAIDFNPRKGTISKLFDKELNKELTTPKAEWEMGEFIYEIIDSRHPME
QYREPQFLRRRPERIRFERYEKGPIWDTYRFRGETVAGREPNNLMVEFRVFNVAKKIDIV
YRLRKKAVIDPEAIYISFPFEVNQGKIMLDVPGGTIEAGVDQIPGSSNDWYTVQNFATAR
NSESQVVMGSPEIPLMQFGAINTGRYKAGAVPQSTNMYSWPMNNYWVTNFNADQMGELQW
SYFINSSKDNSVGYATRFAWENRIPFLTRVLPAGAKGSKVITPASVFNIVPDNVLLVNMK
PVEGEKAVMLQLREIAGKPAKFAVTSDKVNFTGVTVCDVVGEPVKGNPEATFAPWENKFI
KLSW

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]