dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_029162437.1.44790 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment chemotaxis response regulator protein-glutamate methylesterase [Clostridium scatologenes]; AA=GCF_000968375.1; RF=na; TAX=1548; STAX=1548; NAME=Clostridium scatologenes; strain=ATCC 25775; AL=Complete Genome; RT=Major
Sequence length 346
Sequence
MYKSKKVRVLVVDDSLIFRETVAKGIAKDRGIEVVGTASDPFDARDKIIEYEPDVITLDV
EMPKMNGIEFLKRLMPQYPLPVVVVSAVSSNVFDALNAGAVDFVTKPDGRSVNGLEGFIK
ELVTKIKIASVAKVAHWKKKNDERFSNNVIGSNISNKIIAIGSSTGGTEAVATILKMLPK
NIPPIVVVQHMPPVFTRMYAERLNNSCAMEVREAKNGDRLYNGLALIAPGEYHMSLEKRG
TYYYVKCFKGEKVNGHCPAVDVLFESVAKEAGKNAIGIILTGMGYDGAKGLLSMKKRGAI
TIGQNEESCVVYGMPKVAYDIGAVQKQVSIENIAGSLGPFLNGSKV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]