dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_034871636.1.82263 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment MULTISPECIES: glycoside hydrolase [Elizabethkingia]; AA=GCF_002023205.1; RF=na; TAX=1756149; STAX=1756149; NAME=Elizabethkingia genomosp. 3; strain=G0146; AL=Contig; RT=Major
Sequence length 1096
Sequence
MAGNFIYAQKKVPYFGNINAINGYENEISGENIDYFSAFPDHATRALLTRTTDGAKTIEW
ETAKVPQKNSGPYIYFNWLVSHSSGSSGGVRNFDLYINDQKALTLSTYPANQHPTWISKA
ADSTAFVFNQTKMDGLKDSYGIAYLRVPINKVTPGKPLRLKLVGQAQNSRDWFMTYKFTF
QEKMDASATPFILKDGKRLINLTTLHFGPEEKITAKIDNKESFSFTMPDGIKTFDIPVTL
SQTGGNVQLTVTSGKKELLRKTIQAGTIVPRTLYFIHHSHTDVGYSHLQAEVEKIHTKNI
YDALRMIDETRNLPEEARFKWNVEALWDVENFMQKATPEDKKAFVKAVKDGGIGLSVMYG
NILTGLSQPEELFHYTEYAQKLEKEYGLKINSAMMSDVPGFAWSLVPALTTSGVKYFSSG
PNYLGKTNPYLGDRVGNFVKNWGDKPVWWLSPSGKEKILFWTAGRGYSSWHGIHPGAVFE
TGQKKIAEYLDDLTRTNYPYDIVQWRYNIVSDNGPIDPSISKFVDEWNKKYTSPKIVLST
NEKMFEVFEKKYGDQLPVVKGDISPHWEDGAMSTAKEEGINRNSGLKLQQLTTLYSMLNP
RLYNSQHFYDAWRNVILFHEHTWGAFNSITAPDLPFVTDQWKVKRQFSLDGNSLANQLEK
DLLQPLTNPGSKKIEVFNTSSWTRNGVATIPATAEGNSVQDAAGNKIPLQKLENGTMVFM
AKNIPALGSAVYTIIKNKTLATTPFVVTNNSVSNGKITLTWDNKTGSITHFTDNGTTNYA
GSFKNQGLNSYWYVPGSDPNEAKSNTEVQTKILENGPVMVKVLLTADAPGANKLERIITL
YKDSDEALLENIIDKKPVRTKESVHFGFPFNSGFKNITADAGYGIMKYLTDQLPGSNMDY
WYSRRWVDASSGQKGIQWMMIETPLTEAAEMIDERMLIDNSHKKWKDKGTLGTTNWFSYA
MNNYWHTNYKADQEGPVHYRYALRPHDTFNSVENEKYAAAFTQPLIAIPVIEKADIKGSL
FHMKNDKIVVTSITPQNDQSFIIRLYNPDEKEQTTTFTWERLKPSKLIYNKTGKEIFIND
SVSLNSMDVIEIKVIP

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]