dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_036717829.1.41118 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment chemotaxis response regulator protein-glutamate methylesterase [Paracoccus sphaerophysae]; AA=GCF_000763805.1; RF=representative genome; TAX=690417; STAX=690417; NAME=Paracoccus sphaerophysae; strain=HAMBI 3106; AL=Contig; RT=Major
Sequence length 347
Sequence
MRPVRVLIIDDSMTMRRLIRLALSGDPRIDVVGEARDAQQARERLGELRPDVLTLDVEMP
GQSGLDFLERLMAVRPMPVIMVSTETHHGTAAALEALSMGAVECVGKPVNAAAAADFAML
PDLVVAASTALIAPRPAGHQRPAGTPPPTGFIWNGRFVLIGSSTGGVDALERILSEYPSN
CPPTVITQHMPAGFLTSFAQRLNTRIRPTIQLASTGAPLLPGNVYLAPGGDTHLAISSPR
APVCHLVDADKRNGHRPSVDYLFETGAQLGDKAIAVMLTGMGRDGADGMLAMRRARAICL
AQDEATSVVWGMPRVAWESGAVDRLVPLPEIATQILSAAGRAMRAAS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]