dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_039742860.1.89048 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment chemotaxis response regulator protein-glutamate methylesterase [Geobacter pickeringii]; AA=GCF_000817955.1; RF=representative genome; TAX=345632; STAX=345632; NAME=Geobacter pickeringii; strain=G13; AL=Complete Genome; RT=Major
Sequence length 360
Sequence
MKKIKVVVIDDSAFNRRAITKMLEDMPEVEVVGYAADGEEGIRKVIDLKPDLVTLDLEMP
KMDGFTLLRIIMGYKPTPVIVISANSDDEKVFKALEFGAVDFVAKPTSTISEELLKISED
LQQKVRSALHLNMAGIIRRERPALPEPAPKPVKKAAVPPITVGRGRIDVVAIGASTGGPP
ALQSILTSFREAPPFAVVVSQHMPAGFTRTFADRLNRLSVLEIKEAADGDLVRPGRALIA
PGGRNLTFERKGDNVVARIVKPAESDRYIPSVDAMLCSCAVVFGPRALGVILTGMGNDGS
KGVRAIKEAGGMVLAESEKSAVVYGMPKEAAATGMVDKVLPLERMLAEIKLRCGAVVDAG

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]