dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_045583533.1.33993 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment chemotaxis response regulator protein-glutamate methylesterase [Azospirillum thiophilum]; AA=GCF_001305595.1; RF=representative genome; TAX=528244; STAX=528244; NAME=Azospirillum thiophilum; strain=BV-S; AL=Complete Genome; RT=Major
Sequence length 387
Sequence
MSDSLGRGPLTPARPANPDPVRVMVVDDSAVIRGLLTRALEGDPDIRVVTSVGDGQMAVN
SLQRNSIDVIVLDIEMPVMDGLTAIPKLLAVAPQVKIIMASTLTLRGADVSIRCLSAGAA
DYIPKPTSTREIGGAEDFKRELVAKVKALGAAAKRAGSRSRGEIRPLTPALPLGLKRDVG
PIVTRPTPAGALAAKPDVIAIGSSTGGPQALFEVLSHLKAGVSQPILITQHMPATFTTIL
AEHISRQCGIDAREAKDGEPIVQNRCYIAPGDFHMLVVQRGGANVITLSKDPPENFCRPA
VDPMMRSILKAFGGRKILACILTGMGQDGLKGCTDVVNGGGTLIAQDEASSVVWGMPGAV
AQAGICNAILPLKEIGPHIRKLASRAA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]