dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_049774353.1.77901 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment GlyGly-CTERM sorting domain-containing protein [Shewanella woodyi]; AA=GCF_000019525.1; RF=na; TAX=392500; STAX=60961; NAME=Shewanella woodyi ATCC 51908; strain=ATCC 51908; AL=Complete Genome; RT=Major
Sequence length 768
Sequence
MKTAESIARLTKGITLSRLTKSLIISGLIFSSLAQSQAQAIDDSQQTYKVTFPDEQTFLK
ANISLHNEKIKTDPTQRAIWVPLSSDELSRLKPFATSMAKVDDPASLYPQKIASQSNLLS
GIPGYSCYPTVEETQTDIEQLVSQNPNFATIEDIGDSWQKQAGNGGYDLNLLKLTNSQVT
GDKPKLFIHAAMHAREYATSPLVLQFAKDLLSERDTDADSQWLLDRHEIHLLLHMNPDGR
KKAETGLSWRKNANQNYCGSNPNAIGTDLNRNFSWGWNTVEQGSSGNECSNIFRGPSAGS
EPETQAVEAYVRALFGDHRGPNRTDAAPDTTQGLHIDVHSYSELVLWPWGGTNALAPNGA
AMRTLGRKLARFNGYMPMQSVGLYPTDGTSDNLSYGELGIPHMTFELGTDFFQSCSSYND
KVLPDNLKALKYAAKIVEAPYLIPSGPDITEISSVGQPLNAIAQNYRVTLKVTASDDRFS
RRGGTEATQDIAEIALYIDDAPWDGGQATLLTATDGSFDEKTEQGELQLNANDLSLGQHT
LYLKAKDTSGQWGALSAQFIQVIAPQANQAPQANFSFQCDEFTCQFDASSSADPEGDSLS
YAWQLGTGTSREAQPSYQFSSSELTDNKVEVTLTVSDPQGLSHSQTQHLTLSANQAPKAS
FTASCTHLVCQIDASASSDPDADTLSYQWQLGDGNSSDKLQLTHSYTQAGTYNIVLTVSD
GKTDNSSEKSVTVTVAPTPEPSENGSSGGAIGLFSLLLLALGIRRQTR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]