dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_051685759.1.57295 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein [Rheinheimera texasensis]; AA=GCF_000711985.1; RF=representative genome; TAX=1123055; STAX=306205; NAME=Rheinheimera texasensis DSM 17496; strain=DSM 17496; AL=Scaffold; RT=Major
Sequence length 753
Sequence
MLISSLAAVWLNAGLAAAPHQSAAQLQQLQQLSSDNARIVRFASPEQARLAAISLHDALL
GGRWQDSSLILQLDAATEARLAPYAESIHPAYLWQQQQAATAAQPLTDSAQSIPGYACYP
TVEETYSQAEQLVRDYPDYASWHKIGSGWAKTKTGTGYDLYVLKITNRNSGAANKAKLLV
NSAIHAREYATAALTLEFAKDLLGKAGKDADVDWMLAQNEVHLVLQTNPEGRKIAETGVS
WRKNINDTACNSATFGVDLNRNFSFGWFAIPNGSSGNSCDLTYRGVSAGSEPEVQALEQY
ARSLYPDKRGPARTDAAPDNTAGIHIDVHSYSELVLWPWGDTTTPAPNGPALKALGHKLA
WFNNYVPTQSIGLYPTDGTSDGVSYGELGVAAITFEIGTAFFESCANYQANVLPDNLRAL
YYALRVNTAPYLLPAGPDVSQLSLNTTANQIPRNVPLQLKALVSDSQSSGYNGGVASQVI
QSVELTLDQWPDLAGSSSISINATDGKFDSANETISHSLDVSGLSEGRHTLYLRAKDSAG
NSGPVYAGYFNVTAPVVVKPPLPDFTVECQFLRCQFRNTTPGDATLPLEFSWTFAEGATS
TAKDPVYTYSAAGTYQPVLRVTMAGQTEQRSKALQVFAEPQLQLSSNCQNLSCTLTASAS
SANGPVGTVQWSVNNQTLNGQSVNVTFGAAGTYQALAEVSDSAGQKVQKTLSVTVTAPVV
VTPAEPAAKSSSSGGSVGYVSLLLLCILRRRLV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]