dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_052262223.1.52665 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein [Pseudoalteromonas luteoviolacea]; AA=GCF_000814765.1; RF=na; TAX=43657; STAX=43657; NAME=Pseudoalteromonas luteoviolacea; strain=HI1; AL=Scaffold; RT=Major
Sequence length 740
Sequence
MIKTLIKTSLLAAFGALTLPSYAHTQVETNITAHQPNNLNYSLYFSNEDQRVTYSRQYHG
QIVESLHNALVVSLSEKEFLLARSSGAVILEHAPAKTINRAANALVNANQSILTTTQTSG
IPNFPCYPTLEETYELAEQLAEKYPNFVELKHIGQSWKKEQGLGGHDLTVLVIKNKKRNK
HKKLPTMYMQGALHAREYTAGATTIKFAQHLLENRRNNPDIKWILNQREIHILLIANPDG
RKYAELGKEWRKNTNTAYCATNEEQIGADLNRNFDFAWNSTPYSSDEQCSNTYQGPVAAS
EPETQVIQNYINSIFEDNRGELDTDAAPLDTAGLFIDIHSFGGMVMWPWSHLRTPPPNSA
GLSMLGHRLAAYSGYVAYQVGNRFHVGGSAEGYAYGQLGVASFTYELGKEFFEHCGNFEG
EIFPNTLKSLIYAAKVAKAPYKISGGPQILDYKLEGAGDVAVPPGTPINLTAGIYDDFFG
NQSYSPLPPSQAVKKVKLVIKKQGEGVVQRLKLPAADGIYDSPREQLNYALDTSNWDDGR
YTLILKAQDVTGQWGVKYAKYLTIDDDASAQNKAPVADFTPTCTYGTCQFDASKSTDDKP
GLKYRWFIGSETSRKEYSGEKIEYVHEMAGTYYVTLVVEDANDISAVKHAVFDLDGKYLP
IANFTYQCAGLICEFDSSGASDPDGHIVERLWRFGADAMYLPGKVKETFTFPTAGQYRVA
FVVRDNDGQYNETYQFITVN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]