dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_052961164.1.98658 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein [Pseudoalteromonas luteoviolacea]; AA=GCF_001750165.1; RF=representative genome; TAX=43657; STAX=43657; NAME=Pseudoalteromonas luteoviolacea; strain=S4054249; AL=Complete Genome; RT=Major
Sequence length 740
Sequence
MLKKLITTSMLLALGSVTLPLYAHTSSTNGVSSLQRIHKDYSLYFANEEQRVEYAQRYHG
QIINTLHNALIVSLSEKEFLSARASGAVILEHGPALPVNRAANALVKTSQSTLTATQTTG
IPNFPCYPTLEETHEIAEQLAKKYPNFVELKHIGQSWKKEQGIGGHDLTVLVIKNKKRNK
NKKLPTMYMQGALHAREYTAGATTIKFAQHLLENRRTNPDIKWILNQREIHILLIANPDG
RKYAELGKRWRKNTNTAYCATNEEQIGADLNRNFDFGWNSTPNSSDEQCANTYQGPVAAS
EPETQVIQNYINSIFEDNRGELDTDAAPLDTAGLFLDMHSYGGMIMWPWSHLRTPPPNSA
GLSMLGHRLAAYSGYEAHQVGSRFHVGGSADGYAYGHLGVASFTYELGKEFFEHCGNFEG
EIFPNTLKSLIYAAKVAKAPYKISGGPQILDYKLEGAGDVAVPPGTPINLTAGIYDDFFG
YSSYAPLPPSQAVKNVKLIIKKQGEGVVQRLKLPAADGIYDSSREQLNYALDTSNWDDGR
YTLILKAQDVTGQWGVKYAKYLTIDDDASAQNQAPVADFTPTCTYGTCHLDASKSTDDKP
GLKYRWFIGSETSREEYSGEKIEYVHEMAGTYYVSLVVEDANDISAVKHAVLDLDGRYLP
IPNFTYQCSGLTCEFDSSSASDPDGHIVERLWRFGIDAYYLPGNVKETFTFPAAGEYRVA
FVARDNDGQYNETYQFITVN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]