dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_058798177.1.12094 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein [Pseudoalteromonas rubra]; AA=GCF_001482385.1; RF=representative genome; TAX=43658; STAX=43658; NAME=Pseudoalteromonas rubra; strain=SCSIO 6842; AL=Complete Genome; RT=Major
Sequence length 742
Sequence
MKKNLLGMLLLSTISVAATAHSDPHVANIQVSPADNHTLSTYQLAFSSEAQKAEYLSRFH
TAVLQVANSYLVLSLTQQEFAELHSAGALIFSKPGESNLPEAAVQGAISRAQSPVQESGI
PNFSCYPTLAETQRMAQTLAQTYPDFVELKHIGPSWEKSQGLGGHDLTVLVLKNKKKNKW
RKRPALYMQGALHAREYTPGATTLKFAQYLLENRETNADVNWILNQREIHILLIANPDGR
VLAEQGQFWRKNTNTAYCALDETLRGVDLNRNFDFAWASPIGGSTDDQCAATFHGPSPAS
EPETQAIQAYLHELFKDRRGDLLTDPAPLNTQGVFLDLHSFSRFVMWPWSSELTPSPNAD
QLSMMGHRMAAYNGYWAFQTQEIFKAGGSADGYAYGQLGIASFTFELGNEFFESCANFEG
EIFPNNLNALIYAAKVAKRPYKLPAGPQFFDLRLKGAGEEAVPAGTPVEIIATVADDLFG
PSLTGQLPPSQAISKVELTIKKKGKRGRKRILLPAADGAFDTVSESLNYTLDTHRWRNGR
YTLTLRAQDASGQWGPKYAKFLTIDNEAMPGTQSPVADFIADCRKGICGFDGSVTQDDRD
SLTYTWVLQGGQFFRVFHGEQVEIEYTLAGDYQLTLQVDDSHGNRDVKVVPLELDGVIPP
VTQFSYQCTGLICEFNSSASYDPDGEIVERLWRMGNEPYISGAETVVHTFPAPGEYIVVF
VAIDNDGQFSQVAQTIQVTSNE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]