dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_068070033.1.81126 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein [Rheinheimera sp. SA_1]; AA=GCF_001669775.1; RF=na; TAX=1827365; STAX=1827365; NAME=Rheinheimera sp. SA_1; strain=SA_1; AL=Contig; RT=Major
Sequence length 761
Sequence
MHKMYWLTSLFISYPLYAAPLLDDPRLQDFQQQQLQQATEVRFATVELARAAAISHHDVL
LAGHWKDKVLVLQLDNKAKLQLTPFAVAMTPATQWQTAQAAAFSQSNNRSDSSQANQAQA
GISGFPCYETVEESYAIAEQLVRDYPNYASWQPIGPAWAKSNGRPGYDLHVLKLSKNNGV
ANKPVLLINSAIHAREYATAPLMLAFAKSVLEGIGNNADADWMLEQQEIHLLLQTNPEGR
KIAEGGLLWRKNINDASCSSGNYGVDLNRNFSFGWNSAPGGSSGDSCDLTYRGVSAGSEP
ETQALQQYARAVFKDNRGPLRSDAAPATTSGIHLDIHSYSELVLWPWGENASPAPNAAAL
QTLGRKFAWFNDYLPTQSIGLYPTDGTTDGVSYGELGVAAYTFEIGTAFFQSCAVYQNQI
LPDNLKALWYAARVTAAPYLLPSGPEVQGLTMNTVDGKVRQDQSLTLQFQLTDRQTNLQN
GIEPSQPISKAELFINQFPTESATADVVLSAQDGAFDNAVEMVNGTLTSLPLGKHRLYLR
GTDASGQAGPVYASYVEVTPAQEDPLISLDFSVQCQFLRCSFRNLSQIATGSNLVFSWQF
AAGQSSQSAAPEFVFSAAGSYPVSLSTVSLGQPRVVTKTVTVFAEPQVSFSSSCNNLVCD
FTASASSGNGAIVQYNWQLGSVVASGNPLRFTFSGAGSYPVTLTVQDAAGQQANSSQTLT
VTAPPPPPPAAAGKSSGGSWPAVFSLGLWWLYLARRHRSCR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]