dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_076377735.1.95830 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment glycoside hydrolase [Mucilaginibacter lappiensis]; AA=GCF_900155965.1; RF=representative genome; TAX=354630; STAX=354630; NAME=Mucilaginibacter lappiensis; strain=ATCC BAA-1855; AL=Scaffold; RT=Major
Sequence length 971
Sequence
MKIRQSRIKSFCLITILFLLSTVATGVYGQKAQPAFTSITLQPTVAYVNYHGENRRVARL
LFKSGKSYNAGTLSVSFNNHTDNIAIPTSATGLDVFEVPLPGPAIKIATQLTVTLTYNGQ
TYWARCIVEPARDNWTVYVLPHSHVDIGYTNTQAKVLKLHMDNIDESIDLAEKTQNYPAE
ARFKWTTEAIWVVDNYLKQASAEKKARFWSAVKKGWISLDGAYGNINTSMTDSRQLMQMF
AKSQKLAREQGIEIHTMFQGDVPGASWGLAAQAEQTGIHYFLSGPNASDRIGNLAKWQDK
PFYWLSPSGKQKLLFWQCQPYSIGYQLKGAKIPNFFTIDDPKPYYTGHPEENFLNPYLFQ
YLGNLEQNNFPYNMTILTWAMSDNAPIDPELPDAVKAWNEHYTSPKLIITSVKQFFNDLE
KQYKNEIPSFSGDYTEYWTDGVSSAARETALSRITSDRLKQTGAIWAIRNKPAYPVVAFD
DTWKNLLLYHEHTWGAYNSVGEPDNEKVKSEWNVKQGYVLRAEKQVDSLMTEALKPSATQ
THAIDVYNTTNWLRTDVVYIPASLSKTGDLVKDATGKKITSQRLSSGELAFVANAVPALG
KSTYTIYTGKAFSNGQARVSGNSLSNDIYTVAVDAKSGNIVKLIKGATSRNYVAADSAGL
NQYMYMPGDSLKKLVSTTNTQINIKEKGPLVVSLLITSDAPGTQGLTREVRLVSGLDQVE
IINTIDKTAIRNKESVHFAFPFNVPGAQVRYSIPWGSALAEADQLPYANHNWFTMQRWVD
VSNSAYGITWSSPDAPLFEIGSITTGNLLGGLHHAPQWLSFTPQSPVLYSWVMNNLWHTN
FRADQEGKATFHYFIQAHEIGFNNFKANQKGLNNHQPLVVSAATGAPEKGLFLKINGDNI
YVEALKPTDDGQGVIAQLVNSGDTDSEVDITPNTVSTIKVWESNLMEDKLKPLNDRFTIP
AKGVLSVRIER

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]