dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_078406995.1.21739 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment glycoside hydrolase [Elizabethkingia endophytica]; AA=GCF_900092085.1; RF=na; TAX=1606016; STAX=1606016; NAME=Elizabethkingia endophytica; AL=Contig; RT=Major
Sequence length 1096
Sequence
MTGNFIHAQKKVPYFGNINAINGYENEISGENIDYFSAFPDHATRALLTRTTDGEKTIEW
ETTKVPQKNSGPYVYFNWLVSHSSGSSGGVRNFDLYINDQKALTLSTYPANQRPTWISKA
ADSTAFVFNQTKMDGLKDSYGIAYLRVPVNKVTPGKPLRLKLVGQAQNSRDWFMTYKFTF
QEKMDANVTPFILKDGKRLITLTTLHFGPEEKIIAKIDNKESFSFTMPDGIKTFDIPVTL
SQTGGNIQLTVTSGKKELLRKTIQAGTIVPRTLYFIHHSHTDVGYSHLQAEVEKIHTKNI
YDALKMIDETRNLPEEARFKWNVEALWDVENFMQKATPEDKKAFVKAVKDGGIGLSAMYG
NILTGLSQPEELFHYTEYAQKLEKEYGFKINSAMMSDVPGFAWSLVPALTTSGVKYFSSG
PNYLGKTNPYLGDRVGNFVKNWGDKPVWWQSPSGKEKILFWTAGRGYSSWHGIHPGAVFE
TGQKKIAEYLDDLTQTNYPYDIVQWRYNIVSDNGPIDPSISKFVDDWNKKYTSPKIVLST
NEKMFEVFEKKYGDKLPVVKGDISPHWEDGAMSTAKEEGINRNSGLKLQQLTTLYSMLNP
RLYNTQSFYDAWRNVILFHEHTWGAFNSITAPDLPFVTDQWKVKRQFSLEGNSLANQLEK
DLLQPLTNPGSKKIEVFNTSSWARSGVVTIPATADGNSVQDAAGNKIPLQKLENGTMVFM
AKNIPALGSAVYTIIKNKTLATTPFVVTNNSISNGKITLTWDNKTGSITHFTDNGTTNYA
GSYNNQGLNSYWYVPGSDPKEAKSNTEVQTKILENGPVMVKVLLTAEAPGANKLERIITL
YNDSDEALLENIVDKKPVRTKESVHFGFPFNSGFKNITADAGYGIMKYLTDQLPGSNMDY
WYSRRWVDASSGQKGIQWMMIETPLTEAAEMIDERMFIDNSHKKWKDIGTTGTTNWFSYA
MNNYWHTNYKADQEGPVHYRYALRPHDSFNSVENEKYAAAFTQPLIAIPVNEKADIKGSL
FHMKNDKIVVTSITPQDDQSFIIRLYNPDEKEQTTTFTWERLKPSKLIYKKTGKEISIND
SISLNSMDVIEIKVIP

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]