dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_078793981.1.6457 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment glycoside hydrolase [Elizabethkingia miricola]; AA=GCF_002023335.1; RF=na; TAX=172045; STAX=172045; NAME=Elizabethkingia miricola; strain=CSID_3000517120; AL=Contig; RT=Major
Sequence length 1096
Sequence
MTGNFIYAQKKVPYFGNINAINGYENEISGENIDYFSAFPDHATRALLTRTTDGAKIIEW
ETAKVPQKSSAPYVYFNWLVSHSSGSSGGVRNFDLYINDQKALTLSTYPANQHPTWISKA
ADSTAFVFNQTKMDGLKDSYGIAYLRVPINKVTPGKPLRLKLVGQAQNSRDWFMTYKFTF
QEKMDASATPFILKDGKRLINLTTLHFGPEEKITAKIDNKESFSFTMPDGIKTFDIPVTL
SQTGGNVQLTLTSGKKELLRKTIQAGTIVPRTLYFIHHSHTDVGYSHLQAEVEKIHTKNI
YDALKMIDETRNLPEEARFKWNVEALWDVENFMQKATPEDKKAFVKAVKEGGIGLSAMYG
NILTGLSQPEELFHYTEYAQKLEKEYGLKINSAMMSDVPGFAWSLVPALTTSGVKYFSSG
PNYLGKTNPYLGDRVGNFVKNWGDKPVWWQSPSGKEKILFWTAGRGYSSWHGIHPGAVFE
TGQKKIAEYLDDLTRTNYPYDIVQWRYNIVSDNGPIDPSISKFVDEWNKKYTSPKIILST
NENMFEVFEKKYGDQLPVVKGDISPHWEDGAMSTAKEEGINRNSGLKLQQLTTLYSMLNP
HLYNSQRFYDAWRNVILFHEHTWGAFNSITAPDLPFVTDQWKVKRQFSLDGNALANQLEK
DLLQPLTNPGSKKIEVFNTSSWTRSGVVTIPAAAEGNSVQDAAGNKIPLQKLENGTMVFM
AKNIPALGSAVYTIIKNKTLATSPFVVTNNSVSNGKIALTWDNKTGSITHFTDNGATNYA
GSYNNQGLNSYWYVPGSDPNEAKSNTEVHTKILENGAVMVKVLLTAEAPGANKLERIITL
YKDSDEALLENIVDKKPIRTKESVHFGFPFNSGFKNITADAGYGIMKYLTDQLPGSNMDY
WYSRRWVDASSGQKGIQWMMIETPLTEAAEMIDERMLIDNSHKKWKDKGTPGTTNWFSYA
MNNYWHTNYKADQEGPVHYRYALRPHDTFNSVENEKYAAAFTQPLIAIPVNEKADIKGSL
FHMKNDKIVVTNITPQDDQSFIIRLYNPDEKEQTTTFTWERLKPSKLIYNKTGKEISIND
SISLNSMDVTEIKAIQ

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]