dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_087329547.1.49220 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein [Parabacteroides sp. An277]; AA=GCF_002159645.1; RF=na; TAX=1965619; STAX=1965619; NAME=Parabacteroides sp. An277; strain=An277; AL=Contig; RT=Major
Sequence length 966
Sequence
MKTAIIIVGMLLGGIYTSQGATNPDLLQVKIHDFYKYRPDGKAGRSIKLVYQGDKKLENA
KVEIFSKKGNETFPIAVNATPDSIPVLLAPAIGVEQTDTIVASLVIGNERLSQEVIVPSM
RHWTVYIYPHSHVDIGYTNTQENVEFIHKRNLDVAMDLAEKTANYPEDARFRWNPEVVWP
VERYLNSESPEKKKRLLKAIKDGTISVDAGYVSTNTSASSDEELLQLFHWGKKIEKETGK
PVRTMVQTDIPGMSWGVVTAANELGIDYVLSLFNGSDRTGWTHELSFHPFWWIGPDGKSK
VLFLQPGAYTPGALAKGKYFWPKLAGQIDRSKLFPVVQTEHPRENFVDAYLAEMLPKLEK
DKEYPYDIFPMTWCMADNTPIDVDLPDAVKSWNEEYAYPHLKICTATEIMEAFDERWGDQ
LPTLQGDFTEYWTDGLGSSAEKTGESREVKERLVQSEILWSMLHPSEEEPEEMVQEAWRN
MILSTEHTWAFMDPQRQPIQDNILKTKLGYFDTARALTDQLREMTYEDIEDKNSDQLSVF
NTDLWVKSGLVTLPKELADKYGSLCDENGREVVCQRLTTGELVFFAEDVPALGYKNYQLK
QGSASQDHAFATTSPTQLDNGIVQVKVDPLSGDIISLLYQDEEFVDQEALVALNSYRYLK
GGDTSGRAYKPTNVRISIGEQGPLVNSLLIESDAKGCNSLRREVRLVKGSAVVEFNNLVD
KQAITEKEGIHFGFAFNVPQSTVRVNIPWGVMELEKEQLKAGNRNWIALQRWLDVSNEEK
GVTWCSLNACSFESGDLTANIIGGAYESPLWIRKLQPSSTIYSWALNNHWHTNFRLFQDG
KIEFKYRVWPHVGDYDVVSSNQFAMEQYRPMVAVQTKKNFKVKNSLSVNASDKIVLSNYK
TVNEGKNSIVRLFSLSDQDEQVSLSWSKKQPKSIVYIQNGKEVKLSDIKESFFVPAKGAL
SVWINW

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]