dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_090466955.1.24149 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment glycoside hydrolase [Mucilaginibacter sp. OK268]; AA=GCF_900103125.1; RF=na; TAX=1881048; STAX=1881048; NAME=Mucilaginibacter sp. OK268; strain=OK268; AL=Contig; RT=Major
Sequence length 971
Sequence
MKRRQFGIKNFCLITILFLLSTAATGVYGQKAQPAFTSITLQPTVAYVKYHGENRRVARL
LFRNGKSYNAGTLSVSFNNHTDNIAIPASTTGLEVFEVPLPGSAIKIATQATVTLTYNGQ
TYTARCIMEPARDNWSVYVLPHSHVDIGYTNTQAKVLKLHMDNIDESIDLAEKTQNYPAE
ARFKWTTEAIWVVDNYLKQANAEKKARFWNAVKKGWISLDGAYGNINTSMTDSRQLMQMF
AKSQKLAREQGIEIHTMFQGDVPGASWGLAAQAEQTGIHYFLSGPNASDRIGNLAKWQDK
PFYWLSPSGKQKLLFWQCQPYSIGYRLKGTKIPNFFTIDDPKPYYTGHPEENFLNPYLFQ
YLGDLEQNNFPYNMTILTWAMSDNAPIDPELPDAVKAWNEHYTSPKLIITSVKQFFNDLE
KQYKNEIPSFSGDYTEYWTDGVSSAARETALSRITSDRLKQTGAIWAIRNKPAYPVAAFD
DTWKNLLLYNEHTWGAYNSVGEPDNEKVKSEWNVKQGYVLRAEKQVDSLMTEALKPSATQ
ANAIDIYNTTNWPRTDVVYVPASLSKTGDLVKDATGKKIPSQRLSSGELAFVANAVPALG
KKTYTIHAGKAFNNGQAKINGNSLSNGIYTLTVDAKSGNIIKLIRGASGRNYVAADSAGL
NQYMYMPGDSLKKLVSTSNTHISIKEKGPLVVSMLIISDAPGTKGITREVRLVSGLDQVE
IINTIDKTAIRRKESIHFAFPFNVPGAQVRYSIPWGSARAEADQLPYANHNWFTMQRWVD
VSNSAYGITWSSPDAPLFEIGNITTGNLLGGLHHAPQWLSFTPQSPVLYSWVMNNLWHTN
FRADQEGKATFHYFMQAHESGFNSFKANQTGLNNHQPLIVSAATSAPEKGLFFKIDGESI
YIEAIKPTDDGLGVIIQLVNSSDIDSEAAITPNTVAAIKIWESNLMEDKLKELGSHFTIP
AKGVLSVRVDK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]