dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

WP_091987095.1.13075 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein [Pseudoalteromonas denitrificans]; AA=GCF_900112265.1; RF=representative genome; TAX=1123010; STAX=43656; NAME=Pseudoalteromonas denitrificans DSM 6059; strain=DSM 6059; AL=Scaffold; RT=Major
Sequence length 724
Sequence
MEISMTLINALTFAASLTLSSSSPSVYLAEFSDQKQKIKTKISFHHALLASEDDGLLLEL
TNKEVRLLEKKGITLTAADKKWQKKLSTIQRRSSANQMGGIPGFNCYETVEETFTEADKL
VIQNPNLAQWIDIGDSWQKINGDKGYDLKVLKIGKQSLIDPPILFIQSAMHAREYTTAAL
TLDFAKNLLQNYDSDPDINWILNRHQIHILFQTNPDGRKIAETGVFQRKNVNINHCSQGH
TGIDLNRNFSFGWNTVDGGSSGNDCDETYRGTHPASEPEVSAIEAYVRSIYPDVRGESDT
DAAPIDTKGLYLDIHSYSELILWPFGHTETLAPNNKGLQALGRKLAYFNGYDPGQSVGLY
PTDGTSDNLAYGELGIAHITFELGTAFFQSCNIYNNKIKPDNLKALLYAAKAVEAPYLIT
SGPDIASIEITDADDIYITIDVLATDEQFSTKGGIEAKQNINKVWYSIGAYPNEENSLQA
EIKDGAADTSKEVFTARIKRDDLVNDQITVYFKGEDSSNSQGPVSAKTLTLSQPIANADI
NCQGAKCHLLGKEIANSYLWQLEDGRTSINKATDFIFPSLGSYQATYTVTNSIGLHTTQN
YDFTVTELLKPDIKFSAICSNITCKFDASDTIDLDSDNLIYKWDFGDSTYSDTMVTSHDY
ASTGNFTVTLTVTDEHNQTSVLTQEIITTQVVTQEPTLEKTQSSGGSFIYNLLILIVFLR
VKHK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]