dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

XP_001784920.1.60028 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment predicted protein [Physcomitrella patens]; AA=GCF_000002425.3; RF=representative genome; TAX=3218; STAX=3218; NAME=Physcomitrella patens; ecotype=Gransden 2004; AL=Scaffold; RT=Major
Sequence length 551
Sequence
MWSRLRGSILFQAILFSVPFQGTLFSVNGFLKSKNEGESLTARANFGSKLESFGTTEAIA
AEVSVVMDSQWIQDRKYKGVLKINSLGCSGFSVTSRDLPAGAKKGLRQAVEGHHQTPGAF
SSRKARNTTPLEKLPRALARNFVNIPVEILRPLTEREGGIEVFGTPLGNFLIGGTAETSN
RGSADWHDLVANKGNYIVFQNPTFSPASQQIKLFAGNNSKAMTAESSVIRIRESRDYFKI
NFRGTENSMAAGGPAVPIAVQMGTLGDRMTSVAPLPTFRGLPGGYQMTNWNDASESYPGR
SDYGTIPQGIVNVVPLQAVLPSSSQPYVPYSAYQKPIPMKELTNELVSRDPNESLVLTLT
KKMDELAVNLAKDKEKRHKSINMRPNVWCSNCKGQGHLVTECSSPPQMMVHCTFCGDKHT
TANFWNLKKQQQVKQQTMSQPTSWDVNQMQTSQPAEDKGPIQRDSPVHRVEVVNAVLISG
QQKDKNTIQDLDDPIEVTTVAPSKRRTEPISILGRIPILSPQQDEEPTSVSRANFSGTSR
SIPNDHVPIPA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]