dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

XP_002473660.1.31404 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment predicted protein [Postia placenta Mad-698-R]; AA=GCF_000006255.1; RF=representative genome; TAX=561896; STAX=104341; NAME=Postia placenta Mad-698-R; strain=Mad-698-R; AL=Scaffold; RT=Major
Sequence length 446
Sequence
MSSTLPFLDQFNAPSTKGGKRISIYTPKHTHVGDSTLLTLLLKNPTDVFNKLKAHNPEAT
NATDRAALEVYLSACRDYDEAVKAADEAIDHHKRLLCQQDDRVLTELIRLNNLKVAHRFQ
PLLSRSIRARHNKFILCAIPNAYLPLPAPLPTSAFRRPLIPSPFLQAMPRSTTIPADWQP
NPGWTPKGSCRRCGSSRHWVRDCPDVQCAGCGKEAPGHLERECGTRPMKRHVSAPPEEPA
RRVGVVVDNVFLEGIINEAKERKEKERQTKAVPIPSPRSANPEPPPSPVAGPSRPRPDTP
VVFRKVDPDWTPDTILWTWDSSWPNQKHLSGKEWMNVGRNTRKEWFDEEEDDGVDWELYG
DGEQAAEAGLYTGEDKGRLCALVHAQLVHAQLVHAQLVHAQLVHAQLVHAQLVHAQLVHA
QLVCAQLVCAQLVRVQHADAALGARK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]