dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

XP_002614704.1.3285 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein CLUG_05482 [Clavispora lusitaniae ATCC 42720]; AA=GCF_000003835.1; RF=representative genome; TAX=306902; STAX=36911; NAME=Clavispora lusitaniae ATCC 42720; strain=ATCC 42720; AL=Scaffold; RT=Major
Sequence length 346
Sequence
MAVLMHFGMTGMIHLRDVKSHLVFMENGGDKKIKSEKENGDETPELESEPEPQEWPPRFS
KFELELENGQKTELAFVDPRRLARVRLLWGPECSSDELLMQQEPLKRQGPDYSKGGEREV
KKEEGEVKREVKKEEGEVKEEVNKIKEEAEGEEGLAKAEQDVISLFSPSHEPSVSDFPRP
TVFHPDPDPDPHGRARLAFPDFAKLVLSRRKPIKALLLDQAFFAGVGNWVSDEILYHAQI
HPSENLAEHISDPEDPRLARLYYSLIYVMEVSVAVEGNVREFPENWLMLHRWGKRRKEKA
KTKMGYSVAFETVGGRTSCFVPELQKRMGPAVKRRKTSKEKQSDDE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]