dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

XP_002726994.2.4139 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment PREDICTED: MICAL-like protein 1 isoform X2 [Rattus norvegicus]; AA=GCF_000002265.2; RF=na; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=BN; Sprague-Dawley; AL=Chromosome; RT=Major
Sequence length 855
Sequence
MAGPRGALLAWCRRQCEGYRGVDIRDLSSSFRDGLAFCAILHRHRPDLLDFQSLSKENVF
ENNRLAFEVAEKELGIPALLDPNDMVSMSVPDCLSIMTYVSQYYNHFTSSGQAAASPPKP
GKDPAAPSPTSTSPAVQPGEEAQGDDLSPDSLSEQGKPQPPSSACAACGQRVHLVQRYLA
EGRLYHRHCFRCRQCSSTLVPGSYSSGPEEGTFVCAERCTRLGLGGRSGTRPLSLQKQQP
AAAAEAKDGEDSDLSKSVVVVAAEADGLQASSEVQPHTLTKPPLPSKPQDLASPPVSRPT
PAPRKASESSALTPPTPRPRSSLQQDGMVEQSVSGDLVNGRLQELPVPKPRGTPKLSERM
TAPRKDPPWITLVQTEPKKKPAPLPPSSGPGPLSQASRQVENGGLEEKTQKSPAAEPEPK
PYNPFEEEEEEEEASVPAVPSPAPAPPETTPKSLHPWYNITPTSSPKTKKRPAPKAPSAS
PLVLHASRLSHSEPPSATPSPALSVESLSSESSSHTANTEPSEPPAVPKSSSDPAVHVPG
TPGTSANSVTPSAHSSLSSSGELGQPSGEQMPQARTRGSPGTHSTKPFSGATPTPFLLAG
DQKSPAPPMGSSSPQMLIKSSCKENPFNRKPSPSTSPTVRKATKGAKPVRPPAPGHGFPL
IKRKVQADQYIPEEDIYGEMDSIERQLDALEHSGVLLEEKLRGGANEGSEDDMLVDWFKL
IHEKHLLVRRESELIYVFKQQNLEQRQADVEFELRCLLNKPEKDWTDDDRAREKVLMQEL
MTLIEQRDAIVNCLDEDRQREEEEDKMLETMIKKKDFQREAESDSKKKGKFKTMKVLKLL
GNKRDAKSKAPTGKS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]