dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

XP_002812561.1.23681 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment PREDICTED: lymphocyte antigen 75 isoform X3 [Pongo abelii]; AA=GCF_000001545.4; RF=representative genome; TAX=9601; STAX=9601; NAME=Pongo abelii; AL=Chromosome; RT=Major
Sequence length 1722
Sequence
MRTGWATPRPPAGLLMLLFWFFDLAESSGRAANDPFTIVHGNTGKCIKPVYGWIVAEDCD
ETEDKLWKWVSQHRLFHLHSQKCLGLDITKSVNEVRMFSCDSSAMLWWKCEHHSLYGAAQ
YRLALKNGHGTAISNASDVWKKGGSEESLCDQPYHEIYTRDGNSYGRPCEFPFLIGGTWH
HDCILDEDHSGPWCATTLNYEYDRKWGICLKPENGCEDNWEKNEQFGSCYQFNTQTALSW
KEAYVSCQNQGADLLSINSAAELTYLKEKEGIAKIFWIGLNQLYSARGWEWSDHKPLNFL
NWDPDRPSAPTIGGSSCARMDAESGLWQSFSCEAQLPYVCRKPLNNTVELTDVWTYSDTR
CDAGWLPNNGFCYLLVNESNSWDKAHAKCKAFNSDLISIHSLADVEVVVTKLHNEDIKEE
VWIGLKNINIPTLFQWSDGTEVTLTYWDENEPNVPYNKTPNCVSYLGELGQWKVQSCEEK
LKYVCKRKGERLNDTSSDKMCPPDEGWKRRGETCYKIYKDEVPFGTNCNLTITSRFEQEY
LNDLMKKYDKSLRKYFWTGLRDVDSRGEYNWATVGGRRRAVTFSNWNFLEPASPGGCVAM
STGKSIGKWEVKDCRSFKALSICKKISGPLEPEEAAPKPDDPCPEGWQSFPASLSCYKVF
HAERIVRKRNWEEAERFCQALGAHLSSFSHVDEIKEFLHFLTDQFSGQRWLWIGLNKRSP
DLQGSWQWSDRTPVSTIIMPNEFQQDYDIRDCAAVKVFHRPWRRGWLFYDDREFIYLRPF
ACDTKLEWVCQIPKGRTPKTPDWYNPERAGIHGPPLIIEGSEYWFVADLHLNYEEAVLYC
ASNHSFLATITSFVGLKAIKNKIANISGDGQKWWIRISEQPIDDHFTYSRYPWHRFPMTF
GEECLYMSAKTWLIDLGKPTDCSTKLPFICEKYNVSSLEKYSPDSAAKVQCSGQWIPFQN
KCFLKIKPVSLTFSQASDTCHSYGGTLPSVLSQIEQDFITSLLPDMEATLWIGLRWTAYE
KINKWTDNRELTYSNFHPLLVSRRLRIPENFFEEESRYHCALILNLQKSPFTGTWNFTSC
SERHFVSLCQKYSEVKGRQTLQNASETVKYLNNLYKIIPKTLTWHSAKRECLKSNMQLVS
ITDPYQQAFLSVQALLQNSSLWIGLFSQDDELNFGWSDGKRLHFSRWAETNGQLEDCVVL
DIDGFWKTVDCNDNQPGAICYYSGNETEKEVKPVDSVKCPSPVLNTPWIPFQNCCYNFII
TKNRHMATTQEEVHSKCQKLNPKSHILSIRDEKENNFVLEQLLYFNYMASWVMLGITYGN
NSLMWFDKTPLSYTHWRAGRPTIKNEKFLAGLSTDGFWDIQTFKVTEETLYFHQHSILAC
KIEVVDYKEEYNTTLPQFMPYEDGIYSVIQKKVTWYEALNMCSQSGGHLASVHNQNGQLF
LEDIVKRDGFPLWVGLSSHDGSESSFEWSDGSTFDYIPWKGQTSPGNCVLLDPKGTWKHE
KCNSVKDGAICYKPTKSKKLSRLTYSSRCPAAKENGSRWIQYKGHCYKSDQALHSFSEAK
KLCSKHDHSATIVSIKDEDENKFVSRLMRENNNITMRVWLGLSQHSVDQSWSWLDGSEVT
FVKWENKSKSGVGKCSMLIASNETWKKVECEHGFGRVVCKVPLGPDYTAIAIIVATLSIL
VLMGGLIWFLFQRHRLHLAGFSSVRYAQGVNEDEIMLPSFHD

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]