dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

XP_003340069.1.35504 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment PREDICTED: sal-like protein 2 [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence length 1017
Sequence
MSRRKQRKPQQLISDCDGSTTSENGDTGDEDQPQVCAKCCAQFTDPTEFLTHQNTCCTDP
PVMVILGSQENSSSNSSSSSEARAEGQDSPQIMDTEHGNPPDPGPSVPTDASWGPDRARE
DSSDHFLITTAGATSASGGGGLILASPKLGATPLASESTPAPPPPPPPPPPPGAGSGHLN
IPLILEELRVLQQRQIHQMQMTEQICRQVLLLGSLGQSVGTTASPSELPGTGAATSSKTL
LPLFSPIKPGQASKTLTPASSSSSSSSSGAEVPKPTFFHLYHPLGAQHPFSSGSVGRSHK
PTPTPTPSPALPGTTDQLISSPHLAFPGTTGLLAAQCLGAARGLEAASSPGLLKPKNGSG
ELGYGEVMGPLEKPGGRHKCRFCAKVFGSDSALQIHLRSHTGERPYKCNVCGNRFTTRGN
LKVHFHRHREKYPHVQMNPHPVPEHLDYVITGSGLPYGMSVPPEKAEEETTSGGAERKPL
SASATALTATESLTLLSTTAGTATAPGLPTFNKFVLMKAVEPKNKADENTPPGSEGSAVS
GGTETGTTTRMQLSKLVTSLPSWALLTNHFKTSGGFPFPYVLEPLGASPSETSKLQQLVE
KIDRQGAAGAVSTASGASTTSAPAVSSSASSGPNQCVICLRVLSCPRALRLHYGQHGGER
PFKCKVCGRAFSTRGNLRAHFVGHKASPAARAQNSCPICQKKFTNAVTLQQHVRMHLGGQ
IPNGGTILPEGGVAMKESGAEQSAPLAAGVFPQQQQQQQQQPQQQASPEEELSEEEEEEE
EEDEEDITDEDSLAGRGSESGGEKAISMRGDSEEASGPEDETVATIAASGKEMDSGEKSA
QQPSLPLPGNLEEPQSMEHGKNELIGGIEGGGQPEGNSSPTSVLSPEGEVVSAIIAEGPG
IQEARRKEHGESMSSSSNSKRSCGVCGQSCPSQAALEEHHKAHSKEGSLFTCSICKQGFP
ERATLKKHVLLTHHQVQPFAPHGPQSVPSLSLTPGHSASISAPGFCPFARKDDPTIQ

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]