dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

XP_003410315.1.64505 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment PREDICTED: solute carrier family 26 member 9 [Loxodonta africana]; AA=GCF_000001905.1; RF=representative genome; TAX=9785; STAX=9785; NAME=Loxodonta africana; AL=Scaffold; RT=Major
Sequence length 788
Sequence
MNQPRPRYVVDRAAYSLTLFDDEFEKKDRTYPVGKKLRDAFRCSSAKIKTVVFGLFPVLS
WLPKYKIKDYIIPDLLGGLSGGCIQVPQGMAFALLANLPAVNGLYSSFFPLLTYFFLGGV
HQMVPGTFAVISILVGNICLQLAPESKFRVFNNATNESYVDTAAMEAARLHVSATLACLT
AIIQMGLGFMQFGFVAIYLSESFVRGFMTAAGLQILISVLKYVFGLTVPSYAGPGAIVFT
FIDICKNLPNTNMASLIFALISGVFLVLVKELNARYMHKIHFPIPTEMIVVVVATAISGS
YKMPKKYHMQIVGEIQRGFPTPVSPVVSQWKDMIGTAFSLAIVSYVINLAMGRTLANKHG
YDVDSNQEMIALGCSNFFGSFFKIHVICCALSVTLAVDGAGGKSQVASLCVSLVVMITML
VLGSYLSPLPKSVLGALIAVNLKNSLKQLTDPYYLWRKNKLDCCVWVVSFLASFFLSLPY
GVAVGVAFSVLVVVFQTQFRNGCALAQVMDTDIYVNPKTYNRVRETAGVKIVTYCSPLYF
ANSEIFRQKVIAKTGVDPQKVLLAKQKYLKKQEMGRKMPTQHKKSLFMKTKTVSLQELQQ
DFENASPTDPNNNQKPTNGASVSYITFSPDTSSGAHCELPASAESPSDTLASVPPFVTFH
TLILDMSGVSFVDLMGIKALAKLGSTFGKIGVKVFLVNIHAQVYNDISHGGVFEDGGLER
SHIFPSIHDAVLFAQAGTRDVAPGHSFQGAPVDPELSLYDLEEDSPSYWNLEQEMFGSMF
HTETLTAL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]