dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

XP_003581668.1.954 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment PREDICTED: tyrosine decarboxylase 1-like [Brachypodium distachyon]; AA=GCF_000005505.2; RF=representative genome; TAX=15368; STAX=15368; NAME=Brachypodium distachyon; strain=Bd21; AL=Chromosome; RT=Major
Sequence length 553
Sequence
MSSNSCPAAAAATFTTPPGAHPLPLDADAFRRQGRQVADFIADYYDRIEDYPVRPNVSPG
FLAAQLPDAAPSWPEEPDALASALRDVRDLILPGLTHWQSPRHFAHFAATASNAGALGEF
LAAGLNVNPFTWAASPAAAELEVVVTDWLGQALGLPEKLLFRGGSGGGGTLLGTSCEAML
CTIVAARDQKLLKIGEDRIGDLVVYCSDQTHFSFKKAARVAGIRRGNCRVIPTRFEDGFA
LSPAALAAAVRDDVARGKVPLFLCATVGTTATGAVDPVRELCAAVGAGHGSGVWVHVDAA
YAGGACVCPEFRHVAAGAEEADSFSTNPHKWLLANMDCCALWIRRPGLLVAALGAGEDED
AILNKAPPAARGMQADLMVDYKDWQVPLSRRFRALKLWLVLRCHGVEGLRGVVRGHVRMA
AAFEAMVRADPRFEVPVPPAFALVCFRLRPLAAHPGSSSGIDEVNGRLLEAVNGTGRAYM
SGAVVGGAYVLRCAVGNSLTEDRHVREAWSVVQEQADAILAPSDDEDRCCTDQIQTEMEL
QRRPLGAAADVFA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]