dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

XP_003655376.1.77082 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein THITE_71399 [Thielavia terrestris NRRL 8126]; AA=GCF_000226115.1; RF=representative genome; TAX=578455; STAX=35720; NAME=Thielavia terrestris NRRL 8126; strain=NRRL 8126; AL=Complete Genome; RT=Major
Sequence length 242
Sequence
MGESRQELVQWLNSLLQLNITKVEQCGTGAAFCQVYDSIFLDVPMSRVKFNVNTEYAYIQ
NFKILQNTFTKHQIDRSIPVEALVKCKMQDNLEFLQWTKRFWDQHYPGGEYDAVGRRKGS
ALPPSRPTPRAPSGAARRPGGTTPTMGVSRAPVKPAGGAATAALQQENNTLKEMVVGLER
ERDFYFGKLRDIELLIQQLIEEDPELEKQEDGLVVQIQNILSATEEGFEIPEPEQYDDQE
TF

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]