dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

XP_004742791.1.14098 (NCBI 2017_08 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment PREDICTED: rho GTPase-activating protein 28 isoform X2 [Mustela putorius furo]; AA=GCF_000215625.1; RF=representative genome; TAX=9669; STAX=9668; NAME=Mustela putorius furo; breed=Sable; AL=Scaffold; RT=Major
Sequence length 747
Sequence
MLVSAFVLGPERGHAPLRMEVEDSGGVVLTAYHSYARSQPPSSEPRCAPRATASHPGSRK
SIPRCRRINRMLSNESLHSPAFSRSNSQASIDSTSMEEFLREIESIKENSMGGQEEQLPA
EVKPVDEGELEAEWLQDVGLSTLISGNEEEDGKALLSTLTRTQAAAVKKRYNTYTQTMRK
KNKQSVRDVRDIFGVSESPPGDTCDNHTAQLDGTLEEKELPGIIKTSGSLPDGASLNNTT
LSDGSQDEEGGFAVPRSGSVSVLEPLPALPVLSNGSPDPAQAVQNAGSDDDYRKKNIPPE
TEELSFEVSYSEMVTEAPKRSKFKKSDFKKEDYALTKFIVQKTRFGLTEAGDLSAEDMKK
VRHLSLIELTAFFDAFGIQLKRNKTERVKGRDNGIFGVPLTVLLDNDRKKDPGVKVPLVL
QKFFEKVEESGLESEGIFRLSGCTAKVKQYREELDAKFNADKFKWDRMCHREAAVMLKAF
FRELPTSLFPVEYIPAFITLIERGPHIKVQFQALHLMIMALPDANRDTAQALMTFFNKVI
ANESKNRMSIWNISTIMAPNLFFSRSKHSDYEELQLANTAAHIIRLMLKYQKILWKVPSF
LITQVRRMNEATMLLKKQLPSVKKLLRRKTIEREVISPKTSKVLQKSPSSRRMSDVPEGV
IRVHAPLLSKVSMAIQLTSHTKAKDILAKFQYENSHGSSECFKIQNQRLYEIGGNIGQHC
LDPDAYILDIYHVNPQAEWVIKPQPSF

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]